SCOPe 2.07: Domain d1t2ha_: 1t2h A:

Lineage for d1t2ha_ (1t2h A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
   Uniprot P05798

8. Domain d1t2ha_: 1t2h A: [112217]
   complexed with so4; mutant

Details for d1t2ha_

PDB Entry: 1t2h, 1 Å

PDB Description: y81w mutant of rnase sa from streptomyces aureofaciens

PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1t2ha_:

Sequence; same for both SEQRES and ATOM records:

>d1t2ha_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedywtgdhyatfslidqtc

Timeline for d1t2ha_:

• d1t2ha_ first appeared in SCOP 1.71
  
• d1t2ha_ appears in SCOPe 2.06
  
• d1t2ha_ appears in the current release, SCOPe 2.08