Lineage for d1t2ha_ (1t2h A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2531118Protein RNase Sa [53935] (1 species)
  7. 2531119Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. 2531120Domain d1t2ha_: 1t2h A: [112217]
    complexed with so4; mutant

Details for d1t2ha_

PDB Entry: 1t2h (more details), 1 Å

PDB Description: y81w mutant of rnase sa from streptomyces aureofaciens
PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1t2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ha_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedywtgdhyatfslidqtc

SCOPe Domain Coordinates for d1t2ha_:

Click to download the PDB-style file with coordinates for d1t2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1t2ha_: