SCOP 1.71: Domain d1t2ha_: 1t2h A:

Lineage for d1t2ha_ (1t2h A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)

8. Domain d1t2ha_: 1t2h A: [112217]

Details for d1t2ha_

PDB Entry: 1t2h, 1 Å

PDB Description: y81w mutant of rnase sa from streptomyces aureofaciens

SCOP Domain Sequences for d1t2ha_:

Sequence; same for both SEQRES and ATOM records:

>d1t2ha_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedywtgdhyatfslidqtc

Timeline for d1t2ha_:

• d1t2ha_ is new in SCOP 1.71
  
• d1t2ha_ appears in SCOP 1.73
  
• d1t2ha_ appears in the current release, SCOPe 2.08