Lineage for d1t0zb_ (1t0z B:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 621806Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 621807Family g.3.7.1: Long-chain scorpion toxins [57096] (4 proteins)
  6. 621820Protein Scorpion toxin [57097] (17 species)
  7. 621867Species Scorpion (Buthus martensii), BmK IT-AP [TaxId:34649] [118240] (1 PDB entry)
  8. 621869Domain d1t0zb_: 1t0z B: [112214]
    complexed with so4

Details for d1t0zb_

PDB Entry: 1t0z (more details), 2.6 Å

PDB Description: Structure of an Excitatory Insect-specific Toxin with an Analgesic Effect on Mammalian from Scorpion Buthus martensii Karsch

SCOP Domain Sequences for d1t0zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0zb_ g.3.7.1 (B:) Scorpion toxin {Scorpion (Buthus martensii), BmK IT-AP}
kkngyavdssgkvaeclfnnycnnectkvyyadkgyccllkcycfgladdkpvldiwdst
knycdvqiidls

SCOP Domain Coordinates for d1t0zb_:

Click to download the PDB-style file with coordinates for d1t0zb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0zb_: