![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
![]() | Protein Scorpion toxin [57097] (17 species) |
![]() | Species Scorpion (Buthus martensii), BmK IT-AP [TaxId:34649] [118240] (1 PDB entry) Uniprot O77091 19-90 |
![]() | Domain d1t0zb_: 1t0z B: [112214] complexed with so4 |
PDB Entry: 1t0z (more details), 2.6 Å
SCOPe Domain Sequences for d1t0zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0zb_ g.3.7.1 (B:) Scorpion toxin {Scorpion (Buthus martensii), BmK IT-AP [TaxId: 34649]} kkngyavdssgkvaeclfnnycnnectkvyyadkgyccllkcycfgladdkpvldiwdst knycdvqiidls
Timeline for d1t0zb_: