Lineage for d1t0oa1 (1t0o A:315-417)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566046Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 566304Protein Melibiase [75020] (4 species)
  7. 566315Species Trichoderma reesei [TaxId:51453] [110300] (2 PDB entries)
  8. 566317Domain d1t0oa1: 1t0o A:315-417 [112211]
    Other proteins in same PDB: d1t0oa2
    complexed with glb, man, nag

Details for d1t0oa1

PDB Entry: 1t0o (more details), 1.96 Å

PDB Description: the structure of alpha-galactosidase from trichoderma reesei complexed with beta-d-galactose

SCOP Domain Sequences for d1t0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0oa1 b.71.1.1 (A:315-417) Melibiase {Trichoderma reesei}
vygqpatpykwginpdwtfnvtypaefwagpsskghlvlmvntlditatkeakwneipgl
saghyevrdvwsdkdlgclssykaavaahdtavilvgkkcqrw

SCOP Domain Coordinates for d1t0oa1:

Click to download the PDB-style file with coordinates for d1t0oa1.
(The format of our PDB-style files is described here.)

Timeline for d1t0oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t0oa2