Lineage for d1t0ne_ (1t0n E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654119Protein beta2-microglobulin [88600] (4 species)
  7. 654353Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)
  8. 654365Domain d1t0ne_: 1t0n E: [112210]
    Other proteins in same PDB: d1t0na1, d1t0na2, d1t0nd1, d1t0nd2

Details for d1t0ne_

PDB Entry: 1t0n (more details), 1.8 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide
PDB Compounds: (E:) Beta-2-microglobulin

SCOP Domain Sequences for d1t0ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ne_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1t0ne_:

Click to download the PDB-style file with coordinates for d1t0ne_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ne_: