SCOPe 2.03: Domain d1t0nb_: 1t0n B:

Lineage for d1t0nb_ (1t0n B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
   Uniprot P01887

8. Domain d1t0nb_: 1t0n B: [112207]
   Other proteins in same PDB: d1t0na1, d1t0na2, d1t0nd1, d1t0nd2

Details for d1t0nb_

PDB Entry: 1t0n, 1.8 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1t0nb_:

Sequence; same for both SEQRES and ATOM records:

>d1t0nb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1t0nb_:

• d1t0nb_ first appeared in SCOP 1.71
  
• d1t0nb_ appears in SCOPe 2.02
  
• d1t0nb_ appears in SCOPe 2.04
  
• d1t0nb_ appears in the current release, SCOPe 2.08