SCOP 1.71: Domain d1t0md1: 1t0m D:182-278

Lineage for d1t0md1 (1t0m D:182-278)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries)

8. Domain d1t0md1: 1t0m D:182-278 [112202]
   Other proteins in same PDB: d1t0ma2, d1t0mb_, d1t0md2, d1t0me_

Details for d1t0md1

PDB Entry: 1t0m, 2 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide

SCOP Domain Sequences for d1t0md1:

Sequence; same for both SEQRES and ATOM records:

>d1t0md1 b.1.1.2 (D:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d1t0md1:

• d1t0md1 is new in SCOP 1.71
  
• d1t0md1 appears in SCOP 1.73
  
• d1t0md1 appears in the current release, SCOPe 2.08