Lineage for d1t0mb_ (1t0m B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746541Domain d1t0mb_: 1t0m B: [112201]
    Other proteins in same PDB: d1t0ma1, d1t0ma2, d1t0md1, d1t0md2

Details for d1t0mb_

PDB Entry: 1t0m (more details), 2 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1t0mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0mb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1t0mb_:

Click to download the PDB-style file with coordinates for d1t0mb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0mb_: