Lineage for d1t0ma1 (1t0m A:182-278)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106920Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 1106947Domain d1t0ma1: 1t0m A:182-278 [112199]
    Other proteins in same PDB: d1t0ma2, d1t0mb_, d1t0md2, d1t0me_

Details for d1t0ma1

PDB Entry: 1t0m (more details), 2 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1t0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ma1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

SCOPe Domain Coordinates for d1t0ma1:

Click to download the PDB-style file with coordinates for d1t0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1t0ma1: