Lineage for d1t0ma1 (1t0m A:182-278)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021514Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2021804Species Mouse (Mus musculus) [TaxId:10090] [88606] (104 PDB entries)
    Uniprot P01901 22-299
  8. 2021835Domain d1t0ma1: 1t0m A:182-278 [112199]
    Other proteins in same PDB: d1t0ma2, d1t0mb_, d1t0md2, d1t0me_

Details for d1t0ma1

PDB Entry: 1t0m (more details), 2 Å

PDB Description: Conformational switch in polymorphic H-2K molecules containing an HSV peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1t0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ma1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

SCOPe Domain Coordinates for d1t0ma1:

Click to download the PDB-style file with coordinates for d1t0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1t0ma1: