SCOPe 2.01: Domain d1t0fa2: 1t0f A:7-168

Lineage for d1t0fa2 (1t0f A:7-168)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families)

5. Family c.52.1.16: TnsA endonuclease, N-terminal domain [53026] (1 protein)

6. Protein TnsA endonuclease, N-terminal domain [53027] (1 species)
   a catalytic component of the tn7 transposition system

7. Species Escherichia coli [TaxId:562] [53028] (2 PDB entries)
   Uniprot P13988

8. Domain d1t0fa2: 1t0f A:7-168 [112196]
   Other proteins in same PDB: d1t0fa1, d1t0fb1
   complexed with the transposition protein TnsC peptide (Uniprot P05846 505-553), chains C and D
   protein/DNA complex; complexed with mg, mla, mpd

Details for d1t0fa2

PDB Entry: 1t0f, 1.85 Å

PDB Description: crystal structure of the tnsa/tnsc(504-555) complex

PDB Compounds: (A:) Transposon Tn7 transposition protein tnsA

SCOPe Domain Sequences for d1t0fa2:

Sequence; same for both SEQRES and ATOM records:

>d1t0fa2 c.52.1.16 (A:7-168) TnsA endonuclease, N-terminal domain {Escherichia coli [TaxId: 562]}
sfsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelav
flslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeq
faiqvkpaaalqdertleklelerrywqqkqipwfiftdkei

Timeline for d1t0fa2:

• d1t0fa2 first appeared in SCOP 1.71
  
• d1t0fa2 appears in SCOP 1.75
  
• d1t0fa2 appears in SCOPe 2.02
  
• d1t0fa2 appears in the current release, SCOPe 2.08