Lineage for d1t0fa1 (1t0f A:169-268)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762436Family a.4.5.27: TnsA endonuclease, C-terminal domain [46782] (1 protein)
  6. 762437Protein TnsA endonuclease, C-terminal domain [46783] (1 species)
  7. 762438Species Escherichia coli [TaxId:562] [46784] (2 PDB entries)
    Uniprot P13988
  8. 762439Domain d1t0fa1: 1t0f A:169-268 [112195]
    Other proteins in same PDB: d1t0fa2, d1t0fb2
    complexed with the transposition protein TnsC peptide (Uniprot P05846 505-553), chains C and D

Details for d1t0fa1

PDB Entry: 1t0f (more details), 1.85 Å

PDB Description: crystal structure of the tnsa/tnsc(504-555) complex
PDB Compounds: (A:) Transposon Tn7 transposition protein tnsA

SCOP Domain Sequences for d1t0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0fa1 a.4.5.27 (A:169-268) TnsA endonuclease, C-terminal domain {Escherichia coli [TaxId: 562]}
npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt
lseiraltangfikfniyksfrankcadlcisqvvnmeel

SCOP Domain Coordinates for d1t0fa1:

Click to download the PDB-style file with coordinates for d1t0fa1.
(The format of our PDB-style files is described here.)

Timeline for d1t0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t0fa2