SCOP 1.71: Domain d1t0fa1: 1t0f A:169-268

Lineage for d1t0fa1 (1t0f A:169-268)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.27: TnsA endonuclease, C-terminal domain [46782] (1 protein)

6. Protein TnsA endonuclease, C-terminal domain [46783] (1 species)

7. Species Escherichia coli [TaxId:562] [46784] (2 PDB entries)

8. Domain d1t0fa1: 1t0f A:169-268 [112195]
   Other proteins in same PDB: d1t0fa2, d1t0fb2

Details for d1t0fa1

PDB Entry: 1t0f, 1.85 Å

PDB Description: crystal structure of the tnsa/tnsc(504-555) complex

SCOP Domain Sequences for d1t0fa1:

Sequence; same for both SEQRES and ATOM records:

>d1t0fa1 a.4.5.27 (A:169-268) TnsA endonuclease, C-terminal domain {Escherichia coli}
npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt
lseiraltangfikfniyksfrankcadlcisqvvnmeel

Timeline for d1t0fa1:

• d1t0fa1 is new in SCOP 1.71
  
• d1t0fa1 appears in SCOP 1.73
  
• d1t0fa1 appears in the current release, SCOPe 2.08