![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
![]() | Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [118026] (1 PDB entry) Uniprot Q8EBR3 |
![]() | Domain d1t0ac_: 1t0a C: [112194] complexed with co, fpp, zn |
PDB Entry: 1t0a (more details), 1.6 Å
SCOPe Domain Sequences for d1t0ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ac_ d.79.5.1 (C:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Shewanella oneidensis [TaxId: 70863]} kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad lnadvadinvkattteklgftgrkegiaveavvllsrq
Timeline for d1t0ac_: