SCOPe 2.03: Domain d1t0ac_: 1t0a C:

Lineage for d1t0ac_ (1t0a C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Shewanella oneidensis [TaxId:70863] [118026] (1 PDB entry)
   Uniprot Q8EBR3

8. Domain d1t0ac_: 1t0a C: [112194]
   complexed with co, fpp, zn

Details for d1t0ac_

PDB Entry: 1t0a, 1.6 Å

PDB Description: Crystal Structure of 2C-Methyl-D-Erythritol-2,4-cyclodiphosphate Synthase from Shewanella Oneidensis

PDB Compounds: (C:) 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1t0ac_:

Sequence; same for both SEQRES and ATOM records:

>d1t0ac_ d.79.5.1 (C:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Shewanella oneidensis [TaxId: 70863]}
kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
lnadvadinvkattteklgftgrkegiaveavvllsrq

Timeline for d1t0ac_:

• d1t0ac_ first appeared in SCOP 1.71
  
• d1t0ac_ appears in SCOPe 2.02
  
• d1t0ac_ appears in SCOPe 2.04
  
• d1t0ac_ appears in the current release, SCOPe 2.08