Lineage for d1t0ac_ (1t0a C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960358Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2960359Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2960360Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 2960422Species Shewanella oneidensis [TaxId:70863] [118026] (1 PDB entry)
    Uniprot Q8EBR3
  8. 2960425Domain d1t0ac_: 1t0a C: [112194]
    complexed with co, fpp, zn

Details for d1t0ac_

PDB Entry: 1t0a (more details), 1.6 Å

PDB Description: Crystal Structure of 2C-Methyl-D-Erythritol-2,4-cyclodiphosphate Synthase from Shewanella Oneidensis
PDB Compounds: (C:) 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1t0ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ac_ d.79.5.1 (C:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Shewanella oneidensis [TaxId: 70863]}
kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
lnadvadinvkattteklgftgrkegiaveavvllsrq

SCOPe Domain Coordinates for d1t0ac_:

Click to download the PDB-style file with coordinates for d1t0ac_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ac_: