![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.161: beta-catenin-interacting protein ICAT [81729] (1 superfamily) core: 3 helices; irregular array |
![]() | Superfamily a.161.1: beta-catenin-interacting protein ICAT [81730] (1 family) ![]() |
![]() | Family a.161.1.1: beta-catenin-interacting protein ICAT [81731] (1 protein) |
![]() | Protein beta-catenin-interacting protein ICAT [81732] (1 species) consists of a globular N-domain and extended C-terminal tail |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81733] (3 PDB entries) |
![]() | Domain d1t08b_: 1t08 B: [112191] Other proteins in same PDB: d1t08a_ |
PDB Entry: 1t08 (more details), 2.1 Å
SCOP Domain Sequences for d1t08b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t08b_ a.161.1.1 (B:) beta-catenin-interacting protein ICAT {Human (Homo sapiens) [TaxId: 9606]} gkspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvnsqls
Timeline for d1t08b_: