SCOPe 2.08: Domain d1t08b_: 1t08 B:

Lineage for d1t08b_ (1t08 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.161: beta-catenin-interacting protein ICAT [81729] (1 superfamily)
   core: 3 helices; irregular array

4. Superfamily a.161.1: beta-catenin-interacting protein ICAT [81730] (1 family)
   automatically mapped to Pfam PF06384

5. Family a.161.1.1: beta-catenin-interacting protein ICAT [81731] (1 protein)

6. Protein beta-catenin-interacting protein ICAT [81732] (1 species)
   consists of a globular N-domain and extended C-terminal tail

7. Species Human (Homo sapiens) [TaxId:9606] [81733] (3 PDB entries)
   Uniprot Q9NSA3 8-53

8. Domain d1t08b_: 1t08 B: [112191]
   Other proteins in same PDB: d1t08a_

Details for d1t08b_

PDB Entry: 1t08, 2.1 Å

PDB Description: Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3

PDB Compounds: (B:) Beta-catenin-interacting protein 1

SCOPe Domain Sequences for d1t08b_:

Sequence; same for both SEQRES and ATOM records:

>d1t08b_ a.161.1.1 (B:) beta-catenin-interacting protein ICAT {Human (Homo sapiens) [TaxId: 9606]}
gkspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvnsqls

Timeline for d1t08b_:

• d1t08b_ first appeared in SCOP 1.71
  
• d1t08b_ appears in SCOPe 2.07