Lineage for d1t08b_ (1t08 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014002Fold a.161: beta-catenin-interacting protein ICAT [81729] (1 superfamily)
    core: 3 helices; irregular array
  4. 2014003Superfamily a.161.1: beta-catenin-interacting protein ICAT [81730] (1 family) (S)
    automatically mapped to Pfam PF06384
  5. 2014004Family a.161.1.1: beta-catenin-interacting protein ICAT [81731] (1 protein)
  6. 2014005Protein beta-catenin-interacting protein ICAT [81732] (1 species)
    consists of a globular N-domain and extended C-terminal tail
  7. 2014006Species Human (Homo sapiens) [TaxId:9606] [81733] (3 PDB entries)
    Uniprot Q9NSA3 8-53
  8. 2014008Domain d1t08b_: 1t08 B: [112191]
    Other proteins in same PDB: d1t08a_

Details for d1t08b_

PDB Entry: 1t08 (more details), 2.1 Å

PDB Description: Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3
PDB Compounds: (B:) Beta-catenin-interacting protein 1

SCOPe Domain Sequences for d1t08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t08b_ a.161.1.1 (B:) beta-catenin-interacting protein ICAT {Human (Homo sapiens) [TaxId: 9606]}
gkspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvnsqls

SCOPe Domain Coordinates for d1t08b_:

Click to download the PDB-style file with coordinates for d1t08b_.
(The format of our PDB-style files is described here.)

Timeline for d1t08b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t08a_