Lineage for d1t08a_ (1t08 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006339Protein beta-Catenin [48373] (2 species)
  7. 2006340Species Human (Homo sapiens) [TaxId:9606] [48375] (8 PDB entries)
    Uniprot P35222 145-664
  8. 2006342Domain d1t08a_: 1t08 A: [112190]
    Other proteins in same PDB: d1t08b_
    complex with APC peptide (Uniprot P25054 1484-1498), chain C

Details for d1t08a_

PDB Entry: 1t08 (more details), 2.1 Å

PDB Description: Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3
PDB Compounds: (A:) beta-catenin

SCOPe Domain Sequences for d1t08a_:

Sequence, based on SEQRES records: (download)

>d1t08a_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
aelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqnt
ndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllh
qegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalv
nimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtl
rnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggie
alvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwp
likatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvr
meeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdk
eaaeaieaegatapltellhsrnegvatyaaavlfrmse

Sequence, based on observed residues (ATOM records): (download)

>d1t08a_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
aelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqnt
ndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllh
qegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalv
nimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtl
rnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggie
alvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwp
likatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrqfvegvrmeeivegct
galhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieae
gatapltellhsrnegvatyaaavlfrmse

SCOPe Domain Coordinates for d1t08a_:

Click to download the PDB-style file with coordinates for d1t08a_.
(The format of our PDB-style files is described here.)

Timeline for d1t08a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t08b_