Lineage for d1t04d2 (1t04 D:119-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2358971Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2359173Domain d1t04d2: 1t04 D:119-219 [112189]
    Other proteins in same PDB: d1t04a1, d1t04a2, d1t04b1, d1t04c1, d1t04c2, d1t04d1

Details for d1t04d2

PDB Entry: 1t04 (more details), 3 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab in c2 space group
PDB Compounds: (D:) Huzaf Antibody Heavy Chain

SCOPe Domain Sequences for d1t04d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t04d2 b.1.1.2 (D:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d1t04d2:

Click to download the PDB-style file with coordinates for d1t04d2.
(The format of our PDB-style files is described here.)

Timeline for d1t04d2: