Lineage for d1t04c1 (1t04 C:1-108)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. Domain d1t04c1: 1t04 C:1-108 [112186]
    Other proteins in same PDB: d1t04a2, d1t04b1, d1t04b2, d1t04c2, d1t04d1, d1t04d2

Details for d1t04c1

PDB Entry: 1t04 (more details), 3 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab in c2 space group
PDB Compounds: (C:) Huzaf Antibody Light Chain

SCOPe Domain Sequences for d1t04c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t04c1 b.1.1.1 (C:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkr

SCOPe Domain Coordinates for d1t04c1 are not available.

Timeline for d1t04c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t04c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t04a1, d1t04a2, d1t04b1, d1t04b2, d1t04d1, d1t04d2