Lineage for d1t04b2 (1t04 B:119-219)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655304Domain d1t04b2: 1t04 B:119-219 [112185]
    Other proteins in same PDB: d1t04a1, d1t04a2, d1t04b1, d1t04c1, d1t04c2, d1t04d1

Details for d1t04b2

PDB Entry: 1t04 (more details), 3 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab in c2 space group
PDB Compounds: (B:) Huzaf Antibody Heavy Chain

SCOP Domain Sequences for d1t04b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t04b2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOP Domain Coordinates for d1t04b2:

Click to download the PDB-style file with coordinates for d1t04b2.
(The format of our PDB-style files is described here.)

Timeline for d1t04b2: