![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
![]() | Protein Eukaryotic ornithine decarboxylase [51423] (3 species) |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries) Uniprot P07805 |
![]() | Domain d1szrb2: 1szr B:44-283 [112177] Other proteins in same PDB: d1szra1, d1szrb1, d1szrc1, d1szrd1 complexed with orx, plg, pxp; mutant |
PDB Entry: 1szr (more details), 2.15 Å
SCOPe Domain Sequences for d1szrb2:
Sequence, based on SEQRES records: (download)
>d1szrb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa
>d1szrb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristkfgakv edcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildi gggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa
Timeline for d1szrb2: