Lineage for d1szrb2 (1szr B:44-283)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries)
    Uniprot P07805
  8. Domain d1szrb2: 1szr B:44-283 [112177]
    Other proteins in same PDB: d1szra1, d1szrb1, d1szrc1, d1szrd1
    complexed with orx, plg, pxp; mutant

Details for d1szrb2

PDB Entry: 1szr (more details), 2.15 Å

PDB Description: A Dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate
PDB Compounds: (B:) ornithine decarboxylase

SCOPe Domain Sequences for d1szrb2:

Sequence, based on SEQRES records: (download)

>d1szrb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d1szrb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristkfgakv
edcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildi
gggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOPe Domain Coordinates for d1szrb2 are not available.

Timeline for d1szrb2:

Domains from same chain:
(mouse over for more information)
d1szrb1
Domains from other chains:
(mouse over for more information)
d1szra1, d1szra2, d1szrc1, d1szrc2, d1szrd1, d1szrd2