SCOPe 2.08: Domain d1sz6b2: 1sz6 B:138-263

Lineage for d1sz6b2 (1sz6 B:138-263)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
   different sequence variants
   Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity

8. Domain d1sz6b2: 1sz6 B:138-263 [112173]
   Other proteins in same PDB: d1sz6a_
   complexed with azi, cl, gol, nag, so4

Details for d1sz6b2

PDB Entry: 1sz6, 2.05 Å

PDB Description: mistletoe lectin i from viscum album. crystal structure at 2.05 a resolution

PDB Compounds: (B:) beta-galactoside specific lectin I b chain

SCOPe Domain Sequences for d1sz6b2:

Sequence; same for both SEQRES and ATOM records:

>d1sz6b2 b.42.2.1 (B:138-263) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesaggsvwvetctagqenqrwalygdgsirpkqnqsqcltngrd
svstvinivscsagssgqrwvftnagailnlknglamdvaqanpalariiiypatgnpnq
mwlpvp

Timeline for d1sz6b2:

• d1sz6b2 first appeared in SCOP 1.71
  
• d1sz6b2 appears in SCOPe 2.07