SCOP 1.73: Domain d1sz6b1: 1sz6 B:1-137

Lineage for d1sz6b1 (1sz6 B:1-137)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (3 families)

5. Family b.42.2.1: Ricin B-like [50371] (7 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (11 PDB entries)
   different sequence variants

8. Domain d1sz6b1: 1sz6 B:1-137 [112172]
   Other proteins in same PDB: d1sz6a_

Details for d1sz6b1

PDB Entry: 1sz6, 2.05 Å

PDB Description: mistletoe lectin i from viscum album. crystal structure at 2.05 a resolution

PDB Compounds: (B:) beta-galactoside specific lectin I b chain

SCOP Domain Sequences for d1sz6b1:

Sequence; same for both SEQRES and ATOM records:

>d1sz6b1 b.42.2.1 (B:1-137) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagnd

Timeline for d1sz6b1:

• d1sz6b1 first appeared in SCOP 1.71
  
• d1sz6b1 appears in SCOP 1.75
  
• d1sz6b1 appears in the current release, SCOPe 2.08