Lineage for d1sz6b1 (1sz6 B:1-137)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792159Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 2792172Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
    different sequence variants
    Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
  8. 2792175Domain d1sz6b1: 1sz6 B:1-137 [112172]
    Other proteins in same PDB: d1sz6a_
    complexed with azi, cl, gol, nag, so4

Details for d1sz6b1

PDB Entry: 1sz6 (more details), 2.05 Å

PDB Description: mistletoe lectin i from viscum album. crystal structure at 2.05 a resolution
PDB Compounds: (B:) beta-galactoside specific lectin I b chain

SCOPe Domain Sequences for d1sz6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz6b1 b.42.2.1 (B:1-137) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagnd

SCOPe Domain Coordinates for d1sz6b1:

Click to download the PDB-style file with coordinates for d1sz6b1.
(The format of our PDB-style files is described here.)

Timeline for d1sz6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sz6b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1sz6a_