Lineage for d1sz6a_ (1sz6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2605987Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 2605988Species European mistletoe (Viscum album) [TaxId:3972] [56382] (12 PDB entries)
    different sequence variants
    Uniprot P81446 1-249
    Uniprot Q6ITZ3 1-240
  8. 2605994Domain d1sz6a_: 1sz6 A: [112171]
    Other proteins in same PDB: d1sz6b1, d1sz6b2
    complexed with azi, cl, gol, nag, so4

Details for d1sz6a_

PDB Entry: 1sz6 (more details), 2.05 Å

PDB Description: mistletoe lectin i from viscum album. crystal structure at 2.05 a resolution
PDB Compounds: (A:) rRNA n-glycosidase a chain

SCOPe Domain Sequences for d1sz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sz6a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn
aggdsitaaidvtnlyvvayqagqqsyflkdapagaetqdfagttrsslpfngsypdler
yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalppgnvvtltnirdviasl
aimlfvcge

SCOPe Domain Coordinates for d1sz6a_:

Click to download the PDB-style file with coordinates for d1sz6a_.
(The format of our PDB-style files is described here.)

Timeline for d1sz6a_: