SCOP 1.71: Domain d1sz6a_: 1sz6 A:

Lineage for d1sz6a_ (1sz6 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)

6. Protein Mistletoe lectin I A-chain [56381] (1 species)

7. Species European mistletoe (Viscum album) [TaxId:3972] [56382] (10 PDB entries)
   different sequence variants

8. Domain d1sz6a_: 1sz6 A: [112171]
   Other proteins in same PDB: d1sz6b1, d1sz6b2
   complexed with azi, cl, gol, nag, so4

Details for d1sz6a_

PDB Entry: 1sz6, 2.05 Å

PDB Description: mistletoe lectin i from viscum album. crystal structure at 2.05 a resolution

SCOP Domain Sequences for d1sz6a_:

Sequence; same for both SEQRES and ATOM records:

>d1sz6a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)}
yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn
aggdsitaaidvtnlyvvayqagqqsyflkdapagaetqdfagttrsslpfngsypdler
yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalppgnvvtltnirdviasl
aimlfvcge

Timeline for d1sz6a_:

• d1sz6a_ is new in SCOP 1.71
  
• d1sz6a_ appears in SCOP 1.73
  
• d1sz6a_ appears in the current release, SCOPe 2.08