![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (15 proteins) |
![]() | Protein Mistletoe lectin I A-chain [56381] (1 species) |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [56382] (10 PDB entries) different sequence variants |
![]() | Domain d1sz6a_: 1sz6 A: [112171] Other proteins in same PDB: d1sz6b1, d1sz6b2 complexed with azi, cl, gol, nag, so4 |
PDB Entry: 1sz6 (more details), 2.05 Å
SCOP Domain Sequences for d1sz6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sz6a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)} yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn aggdsitaaidvtnlyvvayqagqqsyflkdapagaetqdfagttrsslpfngsypdler yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalppgnvvtltnirdviasl aimlfvcge
Timeline for d1sz6a_: