SCOPe 2.02: Domain d1sz2b1: 1sz2 B:3-321

Lineage for d1sz2b1 (1sz2 B:3-321)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.7: Glucokinase [110627] (1 protein)
   Pfam PF02685

6. Protein Glucokinase Glk [110628] (1 species)

7. Species Escherichia coli [TaxId:562] [110629] (2 PDB entries)
   Uniprot P46880 P0A6V8

8. Domain d1sz2b1: 1sz2 B:3-321 [112170]
   complexed with bgc

Details for d1sz2b1

PDB Entry: 1sz2, 2.2 Å

PDB Description: crystal structure of e. coli glucokinase in complex with glucose

PDB Compounds: (B:) Glucokinase

SCOPe Domain Sequences for d1sz2b1:

Sequence; same for both SEQRES and ATOM records:

>d1sz2b1 c.55.1.7 (B:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]}
kyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgcia
iacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipmlkkehliqfgga
epvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnseeeaiileilraeig
hvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctdcrralslfcvimg
rfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfkeyvhdipvylivhd
npgllgsgahlrqtlghil

Timeline for d1sz2b1:

• d1sz2b1 first appeared in SCOP 1.71
  
• d1sz2b1 appears in SCOPe 2.01
  
• d1sz2b1 does not appear in SCOPe 2.03