Lineage for d1syva2 (1syv A:1-181)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
    Uniprot P30481 25-300
  8. Domain d1syva2: 1syv A:1-181 [112167]
    Other proteins in same PDB: d1syva1, d1syvb_

Details for d1syva2

PDB Entry: 1syv (more details), 1.7 Å

PDB Description: hla-b*4405 complexed to the dominant self ligand eefgraygf
PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d1syva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syva2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

SCOPe Domain Coordinates for d1syva2 are not available.

Timeline for d1syva2:

Domains from same chain:
(mouse over for more information)
d1syva1
Domains from other chains:
(mouse over for more information)
d1syvb_