![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
![]() | Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries) Uniprot P30481 25-300 |
![]() | Domain d1sysa2: 1sys A:1-181 [112164] Other proteins in same PDB: d1sysa1, d1sysb_ |
PDB Entry: 1sys (more details), 2.4 Å
SCOPe Domain Sequences for d1sysa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sysa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]} gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqdaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcveslrrylengketlq r
Timeline for d1sysa2: