Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (76 PDB entries) |
Domain d1sysa1: 1sys A:182-276 [112163] Other proteins in same PDB: d1sysa2, d1sysb_ |
PDB Entry: 1sys (more details), 2.4 Å
SCOP Domain Sequences for d1sysa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sysa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)} adppkthvthhpisdhevtlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrwep
Timeline for d1sysa1: