Lineage for d1sxib_ (1sxi B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520351Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)
  7. 2520352Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. 2520365Domain d1sxib_: 1sxi B: [112150]
    complexed with mg

Details for d1sxib_

PDB Entry: 1sxi (more details), 3 Å

PDB Description: Structure of apo transcription regulator B. megaterium
PDB Compounds: (B:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1sxib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxib_ c.93.1.1 (B:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivqlphriefrqstk

SCOPe Domain Coordinates for d1sxib_:

Click to download the PDB-style file with coordinates for d1sxib_.
(The format of our PDB-style files is described here.)

Timeline for d1sxib_: