SCOP 1.73: Domain d1sxha_: 1sxh A:

Lineage for d1sxha_ (1sxh A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)

8. Domain d1sxha_: 1sxh A: [112147]

Details for d1sxha_

PDB Entry: 1sxh, 2.75 Å

PDB Description: apo structure of B. megaterium transcription regulator

PDB Compounds: (A:) Glucose-resistance amylase regulator

SCOP Domain Sequences for d1sxha_:

Sequence; same for both SEQRES and ATOM records:

>d1sxha_ c.93.1.1 (A:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivqlphriefrqstk

Timeline for d1sxha_:

• d1sxha_ first appeared in SCOP 1.71
  
• d1sxha_ appears in SCOP 1.75
  
• d1sxha_ appears in the current release, SCOPe 2.08