Lineage for d1sxha_ (1sxh A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593209Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 593210Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 593211Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 593248Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)
  7. 593249Species Bacillus megaterium [TaxId:1404] [117741] (4 PDB entries)
  8. 593256Domain d1sxha_: 1sxh A: [112147]

Details for d1sxha_

PDB Entry: 1sxh (more details), 2.75 Å

PDB Description: apo structure of B. megaterium transcription regulator

SCOP Domain Sequences for d1sxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxha_ c.93.1.1 (A:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium}
tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivqlphriefrqstk

SCOP Domain Coordinates for d1sxha_:

Click to download the PDB-style file with coordinates for d1sxha_.
(The format of our PDB-style files is described here.)

Timeline for d1sxha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sxhd_