SCOPe 2.07: Domain d1sxgp_: 1sxg P:

Lineage for d1sxgp_ (1sxg P:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
   Uniprot P46828 58-322 ! Uniprot P46828

8. Domain d1sxgp_: 1sxg P: [112146]
   complexed with 171

Details for d1sxgp_

PDB Entry: 1sxg, 2.75 Å

PDB Description: Structural studies on the apo transcription factor form B. megaterium

PDB Compounds: (P:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1sxgp_:

Sequence; same for both SEQRES and ATOM records:

>d1sxgp_ c.93.1.1 (P:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivqlphriefrqstk

Timeline for d1sxgp_:

• d1sxgp_ first appeared in SCOP 1.71
  
• d1sxgp_ appears in SCOPe 2.06
  
• d1sxgp_ appears in the current release, SCOPe 2.08