![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins) |
![]() | Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species) |
![]() | Species Bacillus megaterium [TaxId:1404] [117741] (4 PDB entries) |
![]() | Domain d1sxgp_: 1sxg P: [112146] complexed with 171; mutant |
PDB Entry: 1sxg (more details), 2.75 Å
SCOP Domain Sequences for d1sxgp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxgp_ c.93.1.1 (P:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium} tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga vamrlltkymnketvdssivqlphriefrqstk
Timeline for d1sxgp_: