Lineage for d1sxgd_ (1sxg D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710422Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 710423Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 710424Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 710464Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)
  7. 710465Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)
  8. 710469Domain d1sxgd_: 1sxg D: [112143]

Details for d1sxgd_

PDB Entry: 1sxg (more details), 2.75 Å

PDB Description: Structural studies on the apo transcription factor form B. megaterium
PDB Compounds: (D:) Glucose-resistance amylase regulator

SCOP Domain Sequences for d1sxgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxgd_ c.93.1.1 (D:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivqlphriefrqstk

SCOP Domain Coordinates for d1sxgd_:

Click to download the PDB-style file with coordinates for d1sxgd_.
(The format of our PDB-style files is described here.)

Timeline for d1sxgd_: