Lineage for d1swya_ (1swy A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 596519Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 596525Protein Phage T4 lysozyme [53982] (1 species)
  7. 596526Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
    many mutant structures
  8. 596527Domain d1swya_: 1swy A: [112138]
    complexed with bme, cl, rb; mutant

Details for d1swya_

PDB Entry: 1swy (more details), 1.06 Å

PDB Description: use of a halide binding site to bypass the 1000-atom limit to ab initio structure determination

SCOP Domain Sequences for d1swya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1swya_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvaaavrgilrnaklkpvydsldavrecalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d1swya_:

Click to download the PDB-style file with coordinates for d1swya_.
(The format of our PDB-style files is described here.)

Timeline for d1swya_: