SCOPe 2.06: Domain d1swwb_: 1sww B:

Lineage for d1swwb_ (1sww B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Phosphonoacetaldehyde hydrolase [56793] (1 species)

7. Species Bacillus cereus [TaxId:1396] [56794] (6 PDB entries)
   Uniprot O31156

8. Domain d1swwb_: 1sww B: [112137]
   complexed with mg, poa; mutant

Details for d1swwb_

PDB Entry: 1sww, 2.3 Å

PDB Description: crystal structure of the phosphonoacetaldehyde hydrolase d12a mutant complexed with magnesium and substrate phosphonoacetaldehyde

PDB Compounds: (B:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d1swwb_:

Sequence; same for both SEQRES and ATOM records:

>d1swwb_ c.108.1.3 (B:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}
kieavifawagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehiek

Timeline for d1swwb_:

• d1swwb_ first appeared in SCOP 1.71
  
• d1swwb_ appears in SCOPe 2.05
  
• d1swwb_ appears in SCOPe 2.07
  
• d1swwb_ appears in the current release, SCOPe 2.08