Lineage for d1swwb_ (1sww B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919616Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919617Protein Phosphonoacetaldehyde hydrolase [56793] (1 species)
  7. 2919618Species Bacillus cereus [TaxId:1396] [56794] (6 PDB entries)
    Uniprot O31156
  8. 2919622Domain d1swwb_: 1sww B: [112137]
    complexed with mg, poa; mutant

Details for d1swwb_

PDB Entry: 1sww (more details), 2.3 Å

PDB Description: crystal structure of the phosphonoacetaldehyde hydrolase d12a mutant complexed with magnesium and substrate phosphonoacetaldehyde
PDB Compounds: (B:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d1swwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1swwb_ c.108.1.3 (B:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}
kieavifawagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehiek

SCOPe Domain Coordinates for d1swwb_:

Click to download the PDB-style file with coordinates for d1swwb_.
(The format of our PDB-style files is described here.)

Timeline for d1swwb_: