Lineage for d1svob_ (1svo B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697666Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 697877Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 697878Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
  8. 697889Domain d1svob_: 1svo B: [112133]
    complexed with zn

Details for d1svob_

PDB Entry: 1svo (more details), 2.6 Å

PDB Description: Structure of SV40 large T antigen helicase domain
PDB Compounds: (B:) large t antigen

SCOP Domain Sequences for d1svob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svob_ c.37.1.20 (B:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOP Domain Coordinates for d1svob_:

Click to download the PDB-style file with coordinates for d1svob_.
(The format of our PDB-style files is described here.)

Timeline for d1svob_: