| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
| Protein Papillomavirus large T antigen helicase domain [89688] (1 species) |
| Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries) Uniprot P03070 265-627 |
| Domain d1svmf_: 1svm F: [112131] complexed with atp, mg, zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 1svm (more details), 1.94 Å
SCOPe Domain Sequences for d1svmf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svmf_ c.37.1.20 (F:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana
aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi
eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg
gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs
vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll
ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig
vld
Timeline for d1svmf_: