SCOP 1.71: Domain d1svmc_: 1svm C:

Lineage for d1svmc_ (1svm C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Papillomavirus large T antigen helicase domain [89688] (1 species)

7. Species Simian virus 40 [TaxId:10633] [89689] (4 PDB entries)

8. Domain d1svmc_: 1svm C: [112128]

Details for d1svmc_

PDB Entry: 1svm, 1.94 Å

PDB Description: Co-crystal structure of SV40 large T antigen helicase domain and ATP

SCOP Domain Sequences for d1svmc_:

Sequence; same for both SEQRES and ATOM records:

>d1svmc_ c.37.1.20 (C:) Papillomavirus large T antigen helicase domain {Simian virus 40}
tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana
aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi
eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg
gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs
vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll
ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig
vld

Timeline for d1svmc_:

• d1svmc_ is new in SCOP 1.71
  
• d1svmc_ appears in SCOP 1.73
  
• d1svmc_ appears in the current release, SCOPe 2.08