Lineage for d1svma_ (1svm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871234Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 2871235Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
    Uniprot P03070 265-627
  8. 2871236Domain d1svma_: 1svm A: [112126]
    complexed with atp, mg, zn
    has additional subdomain(s) that are not in the common domain

Details for d1svma_

PDB Entry: 1svm (more details), 1.94 Å

PDB Description: Co-crystal structure of SV40 large T antigen helicase domain and ATP
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d1svma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOPe Domain Coordinates for d1svma_:

Click to download the PDB-style file with coordinates for d1svma_.
(The format of our PDB-style files is described here.)

Timeline for d1svma_: