Lineage for d1su3b3 (1su3 B:107-270)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607753Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 607766Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 607767Species Human (Homo sapiens) [TaxId:9606] [55530] (11 PDB entries)
  8. 607777Domain d1su3b3: 1su3 B:107-270 [112122]
    Other proteins in same PDB: d1su3a1, d1su3a2, d1su3b1, d1su3b2
    complexed with ca, cl, epe, na, so4, zn

Details for d1su3b3

PDB Entry: 1su3 (more details), 2.2 Å

PDB Description: X-ray structure of human proMMP-1: New insights into collagenase action

SCOP Domain Sequences for d1su3b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su3b3 d.92.1.11 (B:107-270) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpi

SCOP Domain Coordinates for d1su3b3:

Click to download the PDB-style file with coordinates for d1su3b3.
(The format of our PDB-style files is described here.)

Timeline for d1su3b3: