![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily) consists of four 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.66.1: Hemopexin-like domain [50923] (1 family) ![]() |
![]() | Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins) |
![]() | Protein Collagenase (MMP1), C-terminal domain [50929] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117271] (1 PDB entry) |
![]() | Domain d1su3b2: 1su3 B:271-465 [112121] Other proteins in same PDB: d1su3a1, d1su3a3, d1su3b1, d1su3b3 complexed with ca, cl, epe, na, so4, zn |
PDB Entry: 1su3 (more details), 2.2 Å
SCOP Domain Sequences for d1su3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1su3b2 b.66.1.1 (B:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens)} gpqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpnglea ayefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgkty ffvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpk tkriltlqkanswfn
Timeline for d1su3b2: