SCOPe 2.08: Domain d1su3b2: 1su3 B:271-465

Lineage for d1su3b2 (1su3 B:271-465)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein Collagenase (MMP1), C-terminal domain [50929] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117271] (1 PDB entry)
   Uniprot P03956 32-466

8. Domain d1su3b2: 1su3 B:271-465 [112121]
   Other proteins in same PDB: d1su3a1, d1su3a3, d1su3b1, d1su3b3
   complexed with ca, cl, epe, na, so4, zn

Details for d1su3b2

PDB Entry: 1su3, 2.2 Å

PDB Description: X-ray structure of human proMMP-1: New insights into collagenase action

PDB Compounds: (B:) interstitial collagenase

SCOPe Domain Sequences for d1su3b2:

Sequence; same for both SEQRES and ATOM records:

>d1su3b2 b.66.1.1 (B:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gpqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpnglea
ayefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgkty
ffvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpk
tkriltlqkanswfn

Timeline for d1su3b2:

• d1su3b2 first appeared in SCOP 1.71
  
• d1su3b2 appears in SCOPe 2.07